PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof019740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 132aa    MW: 14928 Da    PI: 10.6559
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17418546PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.44.3e-174195357
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               k+++++ eq+++L++ Fe  +++  e++ +LA+ l L+ rqV +WFqNrRa++k+
  Sof019740 41 KKRRLNVEQVRTLKKNFELGNKLEPERKLQLARALCLQPRQVAIWFQNRRARWKN 95
               4568999**********************************************95 PP

2HD-ZIP_I/II110.79.8e-3640119180
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerL 80 
                  ekkrrl+ eqv++L ++Fe  +kLeperK +lar+L lqprqva+WFqnrRAR+k+kqlEk+yeaLkr++da+k e++  
    Sof019740  40 EKKRRLNVEQVRTLKKNFELGNKLEPERKLQLARALCLQPRQVAIWFQNRRARWKNKQLEKEYEALKRQLDAVKGEKKPS 119
                  69***********************************************************************9988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-192097IPR009057Homeodomain-like
SuperFamilySSF466891.24E-192898IPR009057Homeodomain-like
PROSITE profilePS5007116.4713696IPR001356Homeobox domain
SMARTSM003892.3E-1439100IPR001356Homeobox domain
PfamPF000461.7E-144195IPR001356Homeobox domain
CDDcd000868.70E-124197No hitNo description
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MLGKRPMYGA DVVVGGEEVN GGGGGANEDE MSDDGSQAGE KKRRLNVEQV RTLKKNFELG  60
NKLEPERKLQ LARALCLQPR QVAIWFQNRR ARWKNKQLEK EYEALKRQLD AVKGEKKPSF  120
SKTRTLSRNN GA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18896RRARWKNKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.153150.0inflorescence| leaf| meristem| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150309.17e-64homeobox-leucine zipper protein HAT7
SwissprotQ8S7W92e-51HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLB6TNC58e-64B6TNC5_MAIZE; Homeobox-leucine zipper protein HAT7
STRINGGRMZM2G139963_P013e-63(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.19e-46HD-ZIP family protein